PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr006264.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 570aa    MW: 62174.4 Da    PI: 7.8085
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr006264.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-1575121148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
      Pbr006264.1  75 KGGWTPQEDETLSNAVAAFNGKSWKKIAEFFP-DRSEVQCLHRWQKVL 121
                      688*****************************.************986 PP

2Myb_DNA-binding55.81.1e-17127173148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W +eEd++++++v+++G+  W++Ia+ ++ gR +kqc++rw+++l
      Pbr006264.1 127 KGPWIQEEDDKIIELVAKYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 173
                      79******************************.*************97 PP

3Myb_DNA-binding55.51.3e-17179222146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +WT eE++ l +a++++G++ W+ Ia+ ++ gRt++ +k++w++
      Pbr006264.1 179 KEAWTLEEELALMKAHQMHGNK-WAEIAKVLP-GRTDNAIKNHWNS 222
                      579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.95970121IPR017930Myb domain
SMARTSM007173.6E-1374123IPR001005SANT/Myb domain
SuperFamilySSF466892.37E-1675139IPR009057Homeodomain-like
PfamPF002492.6E-1475121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1977129IPR009057Homeodomain-like
CDDcd001679.66E-1278121No hitNo description
PROSITE profilePS5129431.359122177IPR017930Myb domain
SuperFamilySSF466891.41E-30124220IPR009057Homeodomain-like
SMARTSM007173.3E-16126175IPR001005SANT/Myb domain
PfamPF002493.7E-17127173IPR001005SANT/Myb domain
CDDcd001674.20E-15129173No hitNo description
Gene3DG3DSA:1.10.10.602.0E-27130176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-24177228IPR009057Homeodomain-like
SMARTSM007171.3E-16178226IPR001005SANT/Myb domain
PROSITE profilePS5129423.071178228IPR017930Myb domain
PfamPF002493.5E-16179222IPR001005SANT/Myb domain
CDDcd001677.61E-13181224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MSSISIPATS SQAEEEMAGA KLEECCLENK QSMATSSSSV SEGSGSAIIK STGACSPASA  60
SPTQRRTSGP IRRAKGGWTP QEDETLSNAV AAFNGKSWKK IAEFFPDRSE VQCLHRWQKV  120
LNPELVKGPW IQEEDDKIIE LVAKYGPTKW SLIAKSLPGR IGKQCRERWH NHLNPDIKKE  180
AWTLEEELAL MKAHQMHGNK WAEIAKVLPG RTDNAIKNHW NSSLKKKLDS YLTTGTLPPP  240
PKCGAKEPRS NATKKILVRS TKGSDSTAQT SSGNADMSKL DEDGKDQFES AAPPQDMGAS  300
LSVHPNEFAD SEGGNLRLSF MDLSCSNSDS GPKYDNFGVK RKPQIESSVS NGRAESENCG  360
FNNQMDEDRV KTTSFPFETP SYGSLYYEPP PLESSVQFNS GFSSMHRLQN DYTSSPNLSP  420
ISFFTPPCVK GRGLCNQSPE SILKIAAKTF PNTPSILRKR KTIGQGQSPR NKVAIVDCES  480
VREMLYVSSE HKNSAEVSGS QDGSLCESPT SNGISTIGPN GKAFNASPPY RLRARRTAVF  540
KSVEKQLEFT CDEEYDANSM SVELSANGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-69742285159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-69742285159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744600.0DQ074460.1 Malus x domestica MYB4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009350282.10.0PREDICTED: myb-like protein M isoform X1
RefseqXP_009350281.10.0PREDICTED: myb-like protein M isoform X1
TrEMBLQ2LMF20.0Q2LMF2_MALDO; MYB4
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-158myb domain protein 3r-5